KEGG   Rhodopseudomonas palustris BisB5: RPD_3676
Entry
RPD_3676          CDS       T00345                                 
Name
(GenBank) response regulator receiver
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
rpd  Rhodopseudomonas palustris BisB5
Pathway
rpd02020  Two-component system
rpd02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rpd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RPD_3676
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    RPD_3676
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:rpd02022]
    RPD_3676
   02035 Bacterial motility proteins [BR:rpd02035]
    RPD_3676
Two-component system [BR:rpd02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   RPD_3676
Bacterial motility proteins [BR:rpd02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    RPD_3676
SSDB
Motif
Pfam: Response_reg
Other DBs
NCBI-ProteinID: ABE40898
UniProt: Q132U1
LinkDB
Position
complement(4102967..4103332)
AA seq 121 aa
MKTCLVVDDSSVIRKVARRILEGLDFEIVEAEDGEKALEVCKHGLPDAVLLDWNMPVMDG
YEFLRNLRRMPGGDQPKVVFCTTENDVAHIARALHAGANEYIMKPFDKDIVTAKFQEVGL
I
NT seq 366 nt   +upstreamnt  +downstreamnt
atgaagacatgtttggtggtcgacgattcgagcgtcattcgaaaagtcgcaaggcgaatt
ctcgaggggctcgacttcgagatcgtcgaggctgaagacggcgagaaagcgctcgaggtc
tgtaagcacggccttccggacgcggtgctcctcgactggaacatgccggtcatggacggc
tacgaattcctgcgcaatctgcgccggatgccgggcggcgatcagccaaaagtcgttttc
tgcaccactgaaaacgacgtcgcgcacatcgcgcgggcgctgcacgccggcgccaacgaa
tacatcatgaagccgttcgacaaagacatcgtgacggcgaagttccaggaagtcggcctt
atctga

DBGET integrated database retrieval system