Rhodopseudomonas palustris BisA53: RPE_3305 Help Entry RPE_3305          CDS       T00400                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rpe  Rhodopseudomonas palustris BisA53 Pathway rpe01100   Metabolic pathways rpe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rpe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RPE_3305    00074 Mycolic acid biosynthesis     RPE_3305   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RPE_3305 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  ABJ07238 UniProt:  Q07LE6 LinkDB All DBs Position complement(3699041..3699280) Genome browser AA seq 79 aa AA seqDB search MSEIGERVKKIVVEHLGVEPEKVVDAASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA ETILTVGDAVKFLEKNAKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtgagatcggcgagcgggttaagaagatcgtggtggagcaccttggtgttgaaccc gaaaaggtggtcgacgcagccagctttatcgacgacctcggtgcggacagcctcgacacg gtcgagctcgtgatggctttcgaagaagagttcggttgcgaaattccggacgacgccgcc gagaccattctgacggtcggcgatgccgtcaaattcctcgagaagaacgcgaagagctga

DBGET integrated database retrieval system