Roseovarius pelagicus: N7U68_03110 Help Entry N7U68_03110       CDS       T09340                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rpel  Roseovarius pelagicus Pathway rpel01100   Metabolic pathways rpel01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rpel00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     N7U68_03110    00074 Mycolic acid biosynthesis     N7U68_03110   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     N7U68_03110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  UXX83675 LinkDB All DBs Position complement(423362..423622) Genome browser AA seq 86 aa AA seqDB search MSDIPDRVIAIIAEQAVLEPSDVTMSSTLEELGIDSLGLVESIFAIEEEFDINVPFNANE PTESDFDISTVASIVAGITKLVKEQS NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcgacataccggaccgggtgatagccatcatcgcagagcaggctgtactggagcca tccgatgtcacgatgtcgagcacgctcgaagaactgggcatcgacagcctcggtctggtc gaaagcattttcgcgatcgaggaagaattcgacatcaacgttccgttcaatgccaacgaa ccgacagagagcgattttgacatctctaccgttgccagcatcgtcgctggcatcacgaag ctggtgaaagagcagtcgtga

DBGET integrated database retrieval system