Roseovarius pelagicus: N7U68_11490 Help Entry N7U68_11490       CDS       T09340                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism rpel  Roseovarius pelagicus Pathway rpel00362   Benzoate degradation rpel00622   Xylene degradation rpel01100   Metabolic pathways rpel01120   Microbial metabolism in diverse environments rpel01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:rpel00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     N7U68_11490    00622 Xylene degradation     N7U68_11490    00621 Dioxin degradation     N7U68_11490 Enzymes [BR:rpel01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      N7U68_11490 SSDB OrthologParalogGFIT Motif Pfam:  Tautomerase Tautomerase_2 MRX4_C Motif Other DBs NCBI-ProteinID:  UXX81752 UniProt:  A0ABY6D6I2 LinkDB All DBs Position complement(2092474..2092671) Genome browser AA seq 65 aa AA seqDB search MPIIRVEMFEGRSTEQKRNLVSELTTAFVETCGGTPASVQVVITDFTSENWGVGGQLIVD RSKGT NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgcctattatccgtgtcgaaatgttcgaaggccgctcgacagagcaaaaacgcaatctg gtatcagagttgaccactgcgttcgtcgagacctgtggcggcacacctgcgtcggtgcag gtggtcatcaccgatttcacgtctgaaaactggggcgtcgggggacaactgatcgttgac cgaagcaagggaacgtga

DBGET integrated database retrieval system