Roseovarius pelagicus: N7U68_14465 Help Entry N7U68_14465       CDS       T09340                                  Name (GenBank) rod-binding protein   KO K02395   peptidoglycan hydrolase FlgJ Organism rpel  Roseovarius pelagicus Pathway rpel02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:rpel00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     N7U68_14465  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:rpel02035]     N7U68_14465 Bacterial motility proteins [BR:rpel02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     N7U68_14465 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rod-binding Motif Other DBs NCBI-ProteinID:  UXX82295 LinkDB All DBs Position complement(2703038..2703277) Genome browser AA seq 79 aa AA seqDB search MTKSLNARGAAEKLEATFLAEMLKSCGLGTQNSSFGGGVGEEQFASFQRQALADAMVQTG GIGLAEHFYQAILEKSDDR NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgaccaaatcactgaacgcgcgcggcgccgcagagaagctggaggcgacgtttctggct gaaatgctgaaatcctgtggtttgggaacacagaacagcagctttggcggcggcgttggc gaagagcaattcgcatcgtttcagcgtcaggcattggcggacgccatggttcaaaccggc ggcattggcctcgccgaacatttttatcaagccatactggagaagagtgatgacagataa

DBGET integrated database retrieval system