Roseovarius pelagicus: N7U68_18335 Help Entry N7U68_18335       CDS       T09340                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rpel  Roseovarius pelagicus Pathway rpel01100   Metabolic pathways rpel01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rpel00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     N7U68_18335    00074 Mycolic acid biosynthesis     N7U68_18335   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     N7U68_18335 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  UXX83009 UniProt:  A0ABY6DA37 LinkDB All DBs Position 3492333..3492566 Genome browser AA seq 77 aa AA seqDB search MSDIADRVKKIVVEHLGVEEDKVTENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFIKEAS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacatcgcagaccgcgtgaagaaaatcgttgtagagcacttgggcgtggaagaa gacaaagtgactgagaacgcttcgttcatcgacgatctgggcgcagacagcctggacacg gtcgagctggtcatggcgttcgaagaagagttcggcatcgagatccccgacgacgcggct gaaaccatccagacgttcggcgatgcggtgaagttcatcaaagaagcatcctga

DBGET integrated database retrieval system