Ralstonia pickettii 12D: Rpic12D_1156 Help Entry Rpic12D_1156      CDS       T00925                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism rpf  Ralstonia pickettii 12D Pathway rpf02024   Quorum sensing rpf03018   RNA degradation Brite KEGG Orthology (KO) [BR:rpf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     Rpic12D_1156  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     Rpic12D_1156  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:rpf03019]     Rpic12D_1156    03036 Chromosome and associated proteins [BR:rpf03036]     Rpic12D_1156 Messenger RNA biogenesis [BR:rpf03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      Rpic12D_1156 Chromosome and associated proteins [BR:rpf03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     Rpic12D_1156 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 SRP14 Motif Other DBs NCBI-ProteinID:  ACS62448 UniProt:  C6BGR8 LinkDB All DBs Position 1:1222742..1222981 Genome browser AA seq 79 aa AA seqDB search MSNKGQLLQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAI STVVPARAVNFRVDEAPDA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaacaaagggcaattgctacaagacccgtttctgaatgcgctgcgcaaggagcat gtgccggtgtcgatctacctcgtcaacggtatcaagctgcaaggcaacatcgagtcgttc gaccagtacgtcgtgctgctgcgtaacaccgtgacgcagatggtgtacaagcacgcaatc tccaccgtggtgccggcacgtgccgtgaatttccgcgtggacgaagcgcctgacgcctga

DBGET integrated database retrieval system