Ralstonia pickettii 12D: Rpic12D_1244 Help Entry Rpic12D_1244      CDS       T00925                                  Name (GenBank) conserved hypothetical protein   KO K02686   primosomal replication protein N Organism rpf  Ralstonia pickettii 12D Pathway rpf03440   Homologous recombination Brite KEGG Orthology (KO) [BR:rpf00001]  09120 Genetic Information Processing   09124 Replication and repair    03440 Homologous recombination     Rpic12D_1244  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:rpf03400]     Rpic12D_1244 DNA repair and recombination proteins [BR:rpf03400]  Prokaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     RecBC pathway proteins      Rpic12D_1244 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SSB_1 SSB Peptidase_A8 FAD_binding_6 Motif Other DBs NCBI-ProteinID:  ACS62533 UniProt:  C6BH03 LinkDB All DBs Position 1:1317068..1317394 Genome browser AA seq 108 aa AA seqDB search MNETLGDNAINRLQLVATLVEREVMRYTPAGVPIVNCLLAYSGQAVEAQTVRQIEFSMEA LAAGKMASVLDRIAPGTVLDCVGFLARKHRSSKALVFHISGCNVFVKD NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgaacgaaaccctcggggacaacgccatcaaccgcctgcagctcgtcgccactctggtc gagcgcgaggtgatgcgatacaccccagccggcgtgccgatcgtcaattgtctgctggca tacagcgggcaggcggtagaagcgcagacagtgcggcagatcgagttctcgatggaggca ctggcagccggcaagatggcttccgttctagatcgcatcgctccgggcaccgtcctggat tgcgtgggattcctggctcgcaagcaccgcagcagtaaggcactggtctttcacatctcc ggatgtaacgtattcgtaaaggattga

DBGET integrated database retrieval system