Ralstonia pickettii 12D: Rpic12D_3716 Help Entry Rpic12D_3716      CDS       T00925                                  Name (GenBank) anti-sigma-28 factor, FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism rpf  Ralstonia pickettii 12D Pathway rpf02020   Two-component system rpf02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:rpf00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Rpic12D_3716  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     Rpic12D_3716  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:rpf02035]     Rpic12D_3716 Bacterial motility proteins [BR:rpf02035]  Flagellar system   Flagellar assembly proteins    Others     Rpic12D_3716 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  ACS64975 UniProt:  C6BLL7 LinkDB All DBs Position 2:271302..271622 Genome browser AA seq 106 aa AA seqDB search MKINHIVNNAPAAVPTKDATSGSTRAASTTPASTAASGSARHSGDTPSLSVQRVSRQVGS GDFDAARVEQIRSAIQSGTLKMDAGKIADAALSAAQSLLSTRSKKV NT seq 321 nt NT seq  +upstreamnt  +downstreamnt gtgaaaatcaaccatatcgtcaacaacgcaccggccgccgtgccgaccaaggacgccacg tccgggtcgacgcgtgccgcgagcacgactccggccagcaccgcggcctcgggctcggcg cgccacagtggcgacaccccgtcgctatcggtccaacgcgtctcgcgccaggtgggcagc ggcgacttcgacgccgcgcgcgtcgagcagatccgcagcgccatccagagcggcacgctc aagatggacgccggcaagatcgccgatgcggcgctttccgccgcgcaatcgctgctctcc acgcgatccaagaaggtctga

DBGET integrated database retrieval system