Ralstonia pickettii 12D: Rpic12D_4404 Help Entry Rpic12D_4404      CDS       T00925                                  Name (GenBank) conserved hypothetical protein   KO K03746   DNA-binding protein H-NS Organism rpf  Ralstonia pickettii 12D Brite KEGG Orthology (KO) [BR:rpf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:rpf03036]     Rpic12D_4404    03400 DNA repair and recombination proteins [BR:rpf03400]     Rpic12D_4404 Chromosome and associated proteins [BR:rpf03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     Rpic12D_4404 DNA repair and recombination proteins [BR:rpf03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       Rpic12D_4404 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  ACS65647 UniProt:  C6BNI9 LinkDB All DBs Position 2:complement(1034032..1034301) Genome browser AA seq 89 aa AA seqDB search MKEGHPPEPGRETAIAWILEQMQTYDLSVDDLQAHGCFDAPPPPPAPPASIGPVYMSADG QHWDGSGDMPDWLQRAVNAGQSIEHFRVG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaaggaaggtcacccgccggagccgggtcgcgaaaccgcgatcgcctggatcctggaa caaatgcaaacctacgatctgtctgtcgacgatttgcaggcgcatggctgctttgacgcg ccaccgccgccgcccgcaccacctgcgtccatcggcccggtctacatgagcgccgacggc cagcactgggacggctcgggcgacatgcccgactggctgcaacgcgccgtcaatgccgga cagagcatcgaacatttccgcgtgggctga

DBGET integrated database retrieval system