Rickettsia philipii: RSA_06540 Help Entry RSA_06540         CDS       T01759                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rph  Rickettsia philipii Pathway rph01100   Metabolic pathways rph01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rph00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RSA_06540 (acpP)    00074 Mycolic acid biosynthesis     RSA_06540 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RSA_06540 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Ribosomal_L50 DUF1493 PP-binding_2 Mus7 Motif Other DBs NCBI-ProteinID:  AFB26782 UniProt:  H6PV85 LinkDB All DBs Position 1106015..1106260 Genome browser AA seq 81 aa AA seqDB search MSTTDKIEQKVIEMVAEKLNKDKSIITTDSRFIEDLKADSLDTVELMMAIEVEYGIDIPD DEATKIKTVSDVIQYIKERQS NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagtacaacggataagatcgaacagaaagttattgaaatggttgctgaaaagctcaat aaagataaatcgataataactacggattcaagatttatagaagatttgaaagctgatagc cttgataccgtagagttaatgatggcaatagaagttgaatacggtattgatatccctgat gatgaagccactaaaattaaaaccgtatccgatgttatacaatatatcaaagaacgccaa tcttaa

DBGET integrated database retrieval system