Rhizobium phaseoli: AMC79_CH01471 Help Entry AMC79_CH01471     CDS       T04590                                  Symbol acpP Name (GenBank) acyl carrier protein AcpP   KO K02078   acyl carrier protein Organism rpha  Rhizobium phaseoli Pathway rpha01100   Metabolic pathways rpha01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rpha00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AMC79_CH01471 (acpP)    00074 Mycolic acid biosynthesis     AMC79_CH01471 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AMC79_CH01471 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Delta_lysin Motif Other DBs NCBI-ProteinID:  ANL97293 UniProt:  A0A192T668 LinkDB All DBs Position 1494083..1494319 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIDHLGVDADKVVESASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgtaaagaaaattgttattgatcatcttggcgtcgatgcc gacaaggtcgtcgagagcgccagctttatcgacgatctgggcgccgactcgctcgacacg gtcgaacttgtcatggctttcgaagaagaattcggcgttgaaatccccgacgacgctgcc gactcgatcctgacggttggcgatgcagtgaagtttattgagaaggcccaggcctga

DBGET integrated database retrieval system