Roseovarius phycicola: RZ517_02275 Help Entry RZ517_02275       CDS       T10600                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism rphc  Roseovarius phycicola Pathway rphc00190   Oxidative phosphorylation rphc01100   Metabolic pathways Module rphc_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:rphc00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     RZ517_02275  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:rphc00194]     RZ517_02275 Photosynthesis proteins [BR:rphc00194]  Photosystem and electron transport system   F-type ATPase [OT]    RZ517_02275 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  WWR47039 LinkDB All DBs Position 459693..459929 Genome browser AA seq 78 aa AA seqDB search MEGDVVQMGAYIGAGLACTGMGGAAVGVGHVVGNFLSGALRNPSAAGGQTATMFIGIAFS EALGIFSFLVALLLMFAV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggaaggtgacgtcgtacaaatgggtgcatacatcggtgctggtctggcctgtacaggc atgggcggtgctgctgtgggtgtgggccacgttgttgggaacttcctgtcgggcgccctg cgcaacccgtcagcagccggtggccagaccgcaaccatgttcatcggtattgcgttctcg gaagcgctggggatcttctcgttcctcgttgcccttctgctgatgttcgctgtctaa

DBGET integrated database retrieval system