Roseovarius phycicola: RZ517_04775 Help Entry RZ517_04775       CDS       T10600                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rphc  Roseovarius phycicola Pathway rphc01100   Metabolic pathways rphc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rphc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RZ517_04775    00074 Mycolic acid biosynthesis     RZ517_04775   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RZ517_04775 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  WWR47492 UniProt:  A0ABZ2HMB9 LinkDB All DBs Position 925391..925624 Genome browser AA seq 77 aa AA seqDB search MSDIADRVKKIVVEHLGVEEDKVAENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFISEAS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaccgcgtaaaaaagatcgttgtggaacaccttggtgtggaagaa gacaaggtagctgaaaacgcttcctttattgacgatctgggcgcggacagcctcgacacg gtcgaattggttatggccttcgaagaagaattcggcatcgaaattcctgatgacgcagcc gaaaccattcagacctttggtgacgcggtgaagttcatttctgaagcgtcctaa

DBGET integrated database retrieval system