Ruditapes philippinarum (Manila clam): 132726316 Help Entry 132726316         CDS       T09557                                  Name (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism rphi  Ruditapes philippinarum (Manila clam) Pathway rphi04081   Hormone signaling rphi04144   Endocytosis rphi04150   mTOR signaling pathway rphi04310   Wnt signaling pathway rphi04350   TGF-beta signaling pathway rphi05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:rphi00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     132726316    04350 TGF-beta signaling pathway     132726316    04150 mTOR signaling pathway     132726316   09133 Signaling molecules and interaction    04081 Hormone signaling     132726316  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     132726316  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     132726316  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rphi04131]     132726316   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rphi04147]     132726316    04031 GTP-binding proteins [BR:rphi04031]     132726316 Membrane trafficking [BR:rphi04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     132726316 Exosome [BR:rphi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    132726316   Exosomal proteins of other body fluids (saliva and urine)    132726316   Exosomal proteins of colorectal cancer cells    132726316   Exosomal proteins of bladder cancer cells    132726316 GTP-binding proteins [BR:rphi04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     132726316 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Motif Other DBs NCBI-GeneID:  132726316 NCBI-ProteinID:  XP_060567607 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MTYIRKKLVIVGDGACGKTCLLFVFSKDEFPEVYIPTVFENYVADIVVDGKEVEMVLWDT AGQDDYDRLRPLSYPETDVILMCFSVDNVDSLENISEKWAPEVKHFCPNVPIVLVGTKND LRTDEATRLELAKTKQEVVKVEDGRAMAARIGAFSYLECSARTNDGVREVFEEATRAALL GKKKKKKTKCKIF NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atgacttacattcggaaaaagttagtgattgttggagacggagcatgtggcaagacatgc ctactttttgtgttcagtaaagatgaattcccagaagtttacataccaacagtatttgaa aattatgtagcagatattgttgtagacggaaaagaggttgaaatggtattatgggacact gctggtcaagatgactacgatcgactacgtcccctttcatatcctgaaacagatgttatt ctaatgtgcttttcagtagataatgttgacagtttggagaatatatcggaaaaatgggca ccagaagttaaacatttctgtccaaatgttcccattgtcttagttggaaccaaaaatgat ttaagaactgatgaagcaacaagacttgaactggcaaaaactaaacaagaagtagtgaaa gtagaagatggtcgtgccatggctgcacgtataggagcttttagttatctggaatgttcc gcaaggacaaatgatggagttcgagaggtatttgaagaagccacacgtgctgccttgcta ggaaaaaagaagaaaaagaagaccaagtgtaaaatattttga

DBGET integrated database retrieval system