Ruditapes philippinarum (Manila clam): 132731784 Help Entry 132731784         CDS       T09557                                  Name (RefSeq) dynactin subunit 3-like   KO K10425   dynactin 3 Organism rphi  Ruditapes philippinarum (Manila clam) Pathway rphi04145   Phagocytosis rphi04814   Motor proteins Brite KEGG Orthology (KO) [BR:rphi00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     132731784   09142 Cell motility    04814 Motor proteins     132731784  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:rphi03036]     132731784   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:rphi04812]     132731784 Chromosome and associated proteins [BR:rphi03036]  Eukaryotic type   Centrosome formation proteins    Microtubules and associated factors     Dynactin complex      132731784 Cytoskeleton proteins [BR:rphi04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dynactins      132731784 SSDB OrthologParalogGFIT Motif Pfam:  Dynactin_p22 FAM184 COG3_N DUF948 Motif Other DBs NCBI-GeneID:  132731784 NCBI-ProteinID:  XP_060574021 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MTLSEAAKTEIILAEEDFLLQQSARLETLGQLQDTLDSEHIKAVPSLTGKLQDLSELTIE QQDQAGKLSEDIENLLSTYNAIITVLSKQFVKWDETVTKIEQARNSQKVLN NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atgactttatctgaggctgctaaaacggagataatactcgctgaggaagattttctttta caacaatcagcaagactggaaacattgggacagctacaggatacacttgacagtgaacat attaaagctgtacctagcctgactggcaaacttcaagatctgagtgagttaactattgaa caacaagatcaggctggtaaactgtccgaggatattgagaatttgctatccacttacaat gctattattacagtactatccaagcagtttgttaaatgggatgagacagttacaaaaatt gaacaagcaagaaattcacagaaagttctgaattga

DBGET integrated database retrieval system