Ruditapes philippinarum (Manila clam): 132752013 Help Entry 132752013         CDS       T09557                                  Name (RefSeq) calmodulin-like protein 3   KO K02183   calmodulin Organism rphi  Ruditapes philippinarum (Manila clam) Pathway rphi04070   Phosphatidylinositol signaling system Brite KEGG Orthology (KO) [BR:rphi00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     132752013  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:rphi01009]     132752013   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rphi04131]     132752013    03036 Chromosome and associated proteins [BR:rphi03036]     132752013   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rphi04147]     132752013 Protein phosphatases and associated proteins [BR:rphi01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      132752013 Membrane trafficking [BR:rphi04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     132752013 Chromosome and associated proteins [BR:rphi03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      132752013 Exosome [BR:rphi04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    132752013 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 PHY SAPC2_N EF-hand_STIM1 Motif Other DBs NCBI-GeneID:  132752013 NCBI-ProteinID:  XP_060598226 LinkDB All DBs Position Unknown AA seq 90 aa AA seqDB search MAKLQDPEAMLSEAVDTMMKVIDKDGNGLCSKEEFKAFVQEKGETPLKDEEVDELFNAVD TDGDKTTLTRDELLTVLKIGLQANQQSRQS NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggcaaagttacaagaccccgaggctatgctgtctgaggcagttgatacgatgatgaag gtgattgacaaagacggcaacggactttgtagtaaagaggaattcaaggcttttgtacaa gagaaaggcgaaactcctctgaaagacgaagaagttgacgagttatttaatgccgttgat acagatggtgataaaacaacactcactagagatgaattgttgacagttttaaagattgga ttacaagcgaatcagcagtcaaggcaatcatag

DBGET integrated database retrieval system