Ruditapes philippinarum (Manila clam): 132757140 Help Entry 132757140         CDS       T09557                                  Name (RefSeq) ras-like GTP-binding protein RHO   KO K04513   Ras homolog gene family, member A Organism rphi  Ruditapes philippinarum (Manila clam) Pathway rphi04081   Hormone signaling rphi04144   Endocytosis rphi04150   mTOR signaling pathway rphi04310   Wnt signaling pathway rphi04350   TGF-beta signaling pathway rphi04517   IgSF CAM signaling rphi04519   Cadherin signaling rphi05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:rphi00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     132757140    04350 TGF-beta signaling pathway     132757140    04150 mTOR signaling pathway     132757140   09133 Signaling molecules and interaction    04081 Hormone signaling     132757140    04517 IgSF CAM signaling     132757140    04519 Cadherin signaling     132757140  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     132757140  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     132757140  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rphi04131]     132757140   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rphi04147]     132757140    04031 GTP-binding proteins [BR:rphi04031]     132757140 Membrane trafficking [BR:rphi04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     132757140 Exosome [BR:rphi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    132757140   Exosomal proteins of other body fluids (saliva and urine)    132757140   Exosomal proteins of colorectal cancer cells    132757140   Exosomal proteins of bladder cancer cells    132757140 GTP-binding proteins [BR:rphi04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     132757140 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  132757140 NCBI-ProteinID:  XP_060604315 LinkDB All DBs Position Unknown AA seq 188 aa AA seqDB search MSVIRKKLVIVRDGSCGKTCLLTVLSTDRFPEFYIPTVFETSVTDIVMNGNVVEMGLWDT AGQDDYDRLRPLSIPTPMLFLCVPDSLENVSEKWTPEVKHFCYNVPIVLVGNKKDLRNDE STKRELEKRKQEVVTFESGRAMAEHIGAVCYLECSALKNEGVREVFEEATRAALKGEEKK KRIKCKIM NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgtctgtaattcgtaaaaagttagtgatagttagggacggatcttgcggtaaaacttgc cttctaactgtattaagcacagacaggtttcctgaattttatattccaactgtttttgaa actagcgtcacagacattgtaatgaatgggaatgtggtagagatgggcttatgggacaca gccggccaggatgactatgatagactgagacctctttcaatcccgacaccgatgttattc ttatgtgttccagatagtttagaaaatgtatctgaaaaatggacaccagaagtgaaacac ttttgttacaatgttccaattgttcttgttggaaataagaaagacttaagaaatgatgaa tcaactaagcgtgaacttgaaaaaagaaaacaagaagtagtaacgtttgaaagtggacgt gcgatggcggaacatatcggagcagtgtgttatctagaatgttctgctttgaaaaatgaa ggagtgagagaagtgttcgaagaagcaacaagggctgcgttaaaaggggaggaaaagaag aaaagaattaaatgtaaaataatgtga

DBGET integrated database retrieval system