Ruditapes philippinarum (Manila clam): 132759102 Help Entry 132759102         CDS       T09557                                  Name (RefSeq) ADP-ribosylation factor 2-like   KO K07937   ADP-ribosylation factor 1/2 Organism rphi  Ruditapes philippinarum (Manila clam) Pathway rphi04144   Endocytosis Brite KEGG Orthology (KO) [BR:rphi00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     132759102  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rphi04131]     132759102   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rphi04147]     132759102    04031 GTP-binding proteins [BR:rphi04031]     132759102 Membrane trafficking [BR:rphi04131]  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     132759102   Arf GTPases and associated proteins    Arf GTPases     132759102  Endosome - Golgi transport     132759102 Exosome [BR:rphi04147]  Exosomal proteins   Proteins found in most exosomes    132759102 GTP-binding proteins [BR:rphi04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     132759102 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc G-alpha Ras SRPRB Gtr1_RagA 6PF2K MMR_HSR1 Motif Other DBs NCBI-GeneID:  132759102 NCBI-ProteinID:  XP_060606809 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MGAFQSLFRSLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNI SFTVWDVGGQDKIRPLWRHYFQNTQDYVFAMDAPSGAFRGRVQSYVIYTWDFVGCNGASV LNQITAEEI NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgggtgcatttcagtccctgtttagaagtttgtttgggaaaaaggagatgagaattttg atggtggggttggatgcggctggtaaaactacaattttgtacaagctaaaattaggagaa attgttaccactatccccactataggcttcaatgtagaaacagttgaatacaagaacatc agttttacagtatgggatgttggtggacaggataaaatcagaccattgtggagacattat ttccagaatacacaagattatgtttttgcgatggacgcaccctcaggcgcgttccgaggg cgcgttcagagctatgtcatctacacatgggatttcgtcggctgcaatggagcaagtgtc ctcaaccaaataacagccgaagaaata

DBGET integrated database retrieval system