Ralstonia pickettii 12J: Rpic_0310 Help Entry Rpic_0310         CDS       T00762                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rpi  Ralstonia pickettii 12J Pathway rpi01100   Metabolic pathways rpi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rpi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Rpic_0310    00074 Mycolic acid biosynthesis     Rpic_0310   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Rpic_0310 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ACD25469 UniProt:  B2UEX3 LinkDB All DBs Position 1:328523..328783 Genome browser AA seq 86 aa AA seqDB search MNDLEKELAALMIGELNLEDIQLDALTADTPLYGEGFGLDSIDILEVALLISKKYGFELR SGDPDNQKIFASLGSLAAYVAEHRTR NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaacgacctggaaaaagagctcgccgcactcatgatcggcgaactgaatctcgaagac attcaactcgatgccctgaccgccgacacaccgctgtatggcgaaggattcgggctcgat tccatcgatatcctcgaagttgcgttgctgatctccaagaaatacggcttcgagctgcgc tcgggcgatcccgataaccagaagatcttcgcctcgctgggctcgctcgcggcctacgtg gcagagcaccgcacgcgatag

DBGET integrated database retrieval system