Ralstonia pickettii 12J: Rpic_1064 Help Entry Rpic_1064         CDS       T00762                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism rpi  Ralstonia pickettii 12J Pathway rpi02024   Quorum sensing rpi03018   RNA degradation Brite KEGG Orthology (KO) [BR:rpi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     Rpic_1064  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     Rpic_1064  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:rpi03019]     Rpic_1064    03036 Chromosome and associated proteins [BR:rpi03036]     Rpic_1064 Messenger RNA biogenesis [BR:rpi03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      Rpic_1064 Chromosome and associated proteins [BR:rpi03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     Rpic_1064 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 SRP14 Motif Other DBs NCBI-ProteinID:  ACD26212 UniProt:  B2U9V4 LinkDB All DBs Position 1:1131517..1131756 Genome browser AA seq 79 aa AA seqDB search MSNKGQLLQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAI STVVPARAVNFRVDEAPDA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaacaaagggcaattgctacaagacccgtttctgaatgcgctgcgtaaggagcat gtgccggtgtcgatctacctcgtcaacggtatcaagctgcaaggcaacatcgagtcgttc gaccagtacgtcgtgctcctgcgtaataccgtgacgcagatggtgtacaagcacgcaatc tccaccgtggtgccggcccgtgccgtgaatttccgtgtggacgaagcgcctgacgcctga

DBGET integrated database retrieval system