Ralstonia pickettii 12J: Rpic_4793 Help Entry Rpic_4793         CDS       T00762                                  Name (GenBank) anti-sigma-28 factor, FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism rpi  Ralstonia pickettii 12J Pathway rpi02020   Two-component system rpi02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:rpi00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Rpic_4793  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     Rpic_4793  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:rpi02035]     Rpic_4793 Bacterial motility proteins [BR:rpi02035]  Flagellar system   Flagellar assembly proteins    Others     Rpic_4793 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  ACD29877 UniProt:  B2UJX6 LinkDB All DBs Position 2:1129746..1130066 Genome browser AA seq 106 aa AA seqDB search MKINHIVNNAPAAVPTKDATSGSTRAASTTPASTAASGSARHSGDTPSLSVQRVSRQVGS GDFDAARVEQIRSAIQSGTLKMDAGKIADAALSAAQSLLSTRSKKV NT seq 321 nt NT seq  +upstreamnt  +downstreamnt gtgaaaatcaaccatatcgtcaacaacgcaccggccgccgtgccgaccaaggacgccacg tccgggtcgacgcgtgccgcgagcacgactccggccagcaccgcggcctcgggctcggcg cgccacagtggcgacaccccgtcgctatcggtccaacgcgtctcgcgccaggtgggcagc ggcgacttcgacgccgcgcgcgtcgagcagatccgcagcgccatccagagcggcacgctc aagatggacgccggcaagatcgccgatgcggcgctttccgccgcgcaatcgctgctctcc acgcgatccaagaaggtctga

DBGET integrated database retrieval system