Ralstonia pickettii DTP0602: N234_36870 Help Entry N234_36870        CDS       T03172                                  Name (GenBank) DNA-binding protein   KO K03746   DNA-binding protein H-NS Organism rpj  Ralstonia pickettii DTP0602 Brite KEGG Orthology (KO) [BR:rpj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:rpj03036]     N234_36870    03400 DNA repair and recombination proteins [BR:rpj03400]     N234_36870 Chromosome and associated proteins [BR:rpj03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     N234_36870 DNA repair and recombination proteins [BR:rpj03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       N234_36870 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N PRIMA1 Motif Other DBs NCBI-GeneID:  17107282 NCBI-ProteinID:  AGW95638 LinkDB All DBs Position 3:complement(521355..521615) Genome browser AA seq 86 aa AA seqDB search MTAKTERADAIRWIQARMDDYGLTLEDLDAAGCFAPPPPPPPPAPAAPVVCYRNAEGLTW DGQGEMPSWLKRAFHAGQSVEFFRVG NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgacagcaaagactgagcgggcggacgcgatccgctggatccaggcgcggatggacgac tacgggctcaccctcgaagacctcgacgcggcggggtgcttcgcgccgccgcctccacct ccaccgcccgcaccagcggcgccggtggtctgctaccgcaatgcggaggggctgacctgg gacgggcagggcgagatgccgtcgtggctcaagcgggccttccatgcggggcagagcgtc gagtttttccgcgtcgggtag

DBGET integrated database retrieval system