Raoultella planticola: B1209_01455 Help Entry B1209_01455       CDS       T05298                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rpln  Raoultella planticola Pathway rpln01100   Metabolic pathways rpln01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rpln00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B1209_01455    00074 Mycolic acid biosynthesis     B1209_01455   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B1209_01455 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AUV51697 LinkDB All DBs Position complement(319979..320236) Genome browser AA seq 85 aa AA seqDB search MQALYLEIKNLIITTLNLEELSADDIDTDAALFGDGLGLDSIDALELGLAVKNRYGVVLS AESDEMRQHFFSVATLAAFIDAQRT NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgctctatcttgaaattaaaaatctcataattactacgttgaatctggaagaa ctgtcggctgacgacattgacaccgatgcggcactctttggcgatggcctgggtctggac tccatcgacgccctggagctagggctggcggtaaaaaaccgctatggcgtggtgctctcc gccgaaagcgacgagatgcgccagcatttcttctccgttgccaccctggccgcgtttatc gacgctcaacgtacctga

DBGET integrated database retrieval system