Raoultella planticola: B1209_16785 Help Entry B1209_16785       CDS       T05298                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rpln  Raoultella planticola Pathway rpln01100   Metabolic pathways rpln01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rpln00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B1209_16785    00074 Mycolic acid biosynthesis     B1209_16785   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B1209_16785 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 TerB HLH Motif Other DBs NCBI-ProteinID:  AUV54181 LinkDB All DBs Position complement(3474650..3474886) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttccttcgttgaagacctgggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccactgttcaggctgccattgattacatcaacggtcaccaggcgtaa

DBGET integrated database retrieval system