Pararhodospirillum photometricum: RSPPHO_01214 Help Entry RSPPHO_01214      CDS       T01851                                  Symbol hfq Name (GenBank) Protein hfq   KO K03666   host factor-I protein Organism rpm  Pararhodospirillum photometricum Pathway rpm02024   Quorum sensing rpm03018   RNA degradation Brite KEGG Orthology (KO) [BR:rpm00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     RSPPHO_01214 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     RSPPHO_01214 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:rpm03019]     RSPPHO_01214 (hfq)    03036 Chromosome and associated proteins [BR:rpm03036]     RSPPHO_01214 (hfq) Messenger RNA biogenesis [BR:rpm03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      RSPPHO_01214 (hfq) Chromosome and associated proteins [BR:rpm03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     RSPPHO_01214 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 Motif Other DBs NCBI-ProteinID:  CCG07840 UniProt:  H6SSG1 LinkDB All DBs Position complement(1499772..1500161) Genome browser AA seq 129 aa AA seqDB search MLRLQRPPRGDNQGPCRTAIHQDIPGGGDLPSLRDKNESVKGPSMPAEKSQNVQDVFLNH IRKNKAPVTIFLVNGVKLQGIVTWFDNFSLLLRRDGHTQLVYKHAISTIMPSSPVQLFEP SRDEAEAGA NT seq 390 nt NT seq  +upstreamnt  +downstreamnt gtgcttcgtttgcaaagaccgcccaggggtgataaccaggggccgtgccgcactgcgata catcaggacatccccggtggcggggatctcccttcccttagggacaagaacgagagcgtg aaagggccttccatgccggccgaaaagagccagaatgttcaagacgtttttctgaaccac attcgcaagaacaaggcgccggttaccattttcctggtcaatggcgtgaaactgcagggc attgtgacttggtttgacaatttttccctgctgctgcgtcgcgatggccatacccagctt gtctacaagcacgccatttccaccatcatgccgtcgtctcccgtgcaactcttcgagccg agccgcgacgaggccgaggcgggagcctga

DBGET integrated database retrieval system