Pararhodospirillum photometricum: RSPPHO_01367 Help Entry RSPPHO_01367      CDS       T01851                                  Name (GenBank) Acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism rpm  Pararhodospirillum photometricum Pathway rpm01100   Metabolic pathways rpm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rpm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RSPPHO_01367    00074 Mycolic acid biosynthesis     RSPPHO_01367   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RSPPHO_01367 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  CCG07993 UniProt:  H6SJ28 LinkDB All DBs Position complement(1661024..1661260) Genome browser AA seq 78 aa AA seqDB search MSDVAERVKKIVVEHLGVDEAKVTETASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA EKILTVKDAIEFIESHSG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgtcgccgagcgcgtgaagaagatcgttgtcgagcacctgggcgttgacgag gccaaggtcaccgagaccgccagcttcatcgatgatctgggggcggacagcctcgacacc gtcgagctggtcatggctttcgaagaagaattcggctgcgagatccccgacgacgccgcc gagaagatcctgaccgtcaaggacgccatcgagttcatcgagagccacagcggctga

DBGET integrated database retrieval system