KEGG Orthology (KO) [BR:rpne00001]
09120 Genetic Information Processing
09124 Replication and repair
03430 Mismatch repair
NCTC8284_00778 (dam_1)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03032 DNA replication proteins [BR:rpne03032]
NCTC8284_00778 (dam_1)
03400 DNA repair and recombination proteins [BR:rpne03400]
NCTC8284_00778 (dam_1)
09183 Protein families: signaling and cellular processes
02048 Prokaryotic defense system [BR:rpne02048]
NCTC8284_00778 (dam_1)
Enzymes [BR:rpne01000]
2. Transferases
2.1 Transferring one-carbon groups
2.1.1 Methyltransferases
2.1.1.72 site-specific DNA-methyltransferase (adenine-specific)
NCTC8284_00778 (dam_1)
DNA replication proteins [BR:rpne03032]
Prokaryotic type
DNA Replication Termination Factors
DNA methylation enzymes
NCTC8284_00778 (dam_1)
DNA repair and recombination proteins [BR:rpne03400]
Prokaryotic type
SSBR (single strand breaks repair)
MMR (mismatch excision repair)
Other MMR factors
NCTC8284_00778 (dam_1)
Prokaryotic defense system [BR:rpne02048]
Restriction and modification system (R-M system)
Type II R-M system
DNA methyltransferases
NCTC8284_00778 (dam_1)
171 aa
MKWAGGKFRLTDDINKAFPKKKQCLIEPFVGAGAVFLNSNFERYILADINPDLINLFNIV
KDNVDQYIDACKPIFFSPHANTPEYYYAKRQQFNESRDPFERSVIFLYLNRFGFNGLCRY
NSKNEFNVPFGDYKTHYFPEDELRYFAYKAQSAVFYVVILNKLLNWRIKHR