Rodentibacter pneumotropicus: NCTC8284_02271 Help Entry NCTC8284_02271    CDS       T05800                                  Symbol ychN_1 Name (GenBank) protein ychN   KO K06039   uncharacterized protein involved in oxidation of intracellular sulfur Organism rpne  Rodentibacter pneumotropicus Brite KEGG Orthology (KO) [BR:rpne00001]  09190 Not Included in Pathway or Brite   09193 Unclassified: signaling and cellular processes    99994 Others     NCTC8284_02271 (ychN_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DsrE Motif Other DBs NCBI-ProteinID:  VEH67085 UniProt:  A0A448MPL3 LinkDB All DBs Position 1:complement(1394762..1394992) Genome browser AA seq 76 aa AA seqDB search MSDAVSGALAKQNPAEGYHLQQMLEILTSQGATVKLCKTCTNARGITDLSLTEGVEIGTL AELADWTIEADKVLNF NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgtccgatgcggtgagcggggcattggcaaaacaaaatccggcggaagggtatcattta caacaaatgttagaaattttaacctcacagggggcgaccgtaaaactttgcaaaacctgt accaatgcaaggggtataacggatttatctttgacggaaggggtagaaatcggcacattg gcagagcttgccgattggacgatagaagcggataaagtgctaaatttttaa

DBGET integrated database retrieval system