Rodentibacter pneumotropicus: NCTC8284_03892 Help Entry NCTC8284_03892    CDS       T05800                                  Symbol groES Name (GenBank) chaperonin GroES   KO K04078   chaperonin GroES Organism rpne  Rodentibacter pneumotropicus Brite KEGG Orthology (KO) [BR:rpne00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:rpne03110]     NCTC8284_03892 (groES)    03029 Mitochondrial biogenesis [BR:rpne03029]     NCTC8284_03892 (groES) Chaperones and folding catalysts [BR:rpne03110]  Heat shock proteins   HSP10    NCTC8284_03892 (groES) Mitochondrial biogenesis [BR:rpne03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     NCTC8284_03892 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  VEH68653 UniProt:  A0A3S4TXY4 LinkDB All DBs Position 1:2378590..2378841 Genome browser AA seq 83 aa AA seqDB search MNIRPLHDRLIIKREEVETLSAGGIVLTGSAATKSTRAKVLAVGKGRILENGTVQPLDVK VGDTVIFNDGYGVKSEKSMVKKC NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaatattcgtccattacacgatcgtttgattatcaaacgtgaagaagttgaaacctta tcagcaggcggtatcgtattaaccggttctgcagcgacaaaatcaacccgagcaaaagta ttagcggtagggaaaggtcgtattttggaaaacggtacagttcagcctttggatgttaaa gttggcgatacggtgattttcaatgatggttatggtgtgaaaagcgaaaaatcgatggtg aagaagtgttaa

DBGET integrated database retrieval system