Rhodophyticola porphyridii: ABWH90_09930 Help Entry ABWH90_09930      CDS       T11241                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rpoh  Rhodophyticola porphyridii Pathway rpoh01100   Metabolic pathways rpoh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rpoh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ABWH90_09930    00074 Mycolic acid biosynthesis     ABWH90_09930   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ABWH90_09930 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N PP-binding_2 ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  XHC04916 LinkDB All DBs Position complement(1993254..1993487) Genome browser AA seq 77 aa AA seqDB search MSDIADRVKKIVVEHLSVEEDKVTENASFIDDLGADLLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFIKEAS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacatcgcagatcgcgtgaagaaaatcgtcgtcgagcacctgagcgtggaagag gacaaagtaactgaaaacgcctcgttcatcgatgatctgggcgcagatttgctcgatacc gttgaactggtcatggcattcgaagaggaattcggcatcgagattccggacgatgcggcc gaaaccattcagactttcggcgatgcggtgaaattcatcaaggaagcatcgtaa

DBGET integrated database retrieval system