KEGG   Rhodophyticola porphyridii: ABWH90_14365
Entry
ABWH90_14365      CDS       T11241                                 
Name
(GenBank) exonuclease domain-containing protein
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
rpoh  Rhodophyticola porphyridii
Pathway
rpoh03030  DNA replication
rpoh03430  Mismatch repair
rpoh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:rpoh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    ABWH90_14365
   03430 Mismatch repair
    ABWH90_14365
   03440 Homologous recombination
    ABWH90_14365
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rpoh03032]
    ABWH90_14365
   03400 DNA repair and recombination proteins [BR:rpoh03400]
    ABWH90_14365
Enzymes [BR:rpoh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     ABWH90_14365
DNA replication proteins [BR:rpoh03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     ABWH90_14365
DNA repair and recombination proteins [BR:rpoh03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     ABWH90_14365
SSDB
Motif
Pfam: RNase_T DNA_pol_A_exo1 PAS_4 PAS_9 DEDDh_C
Other DBs
NCBI-ProteinID: XHC05734
LinkDB
Position
2871653..2873644
AA seq 663 aa
MFTHLSLRLRIFLFFALLAVGGSALMIAGLTLGYIRLGEDHALQSFVIAGAIGVLAIFGL
TAWVWVLFDENVARPVERLAADMRARAHADVDLDIDHAPARYLGDLAPAAAAVASNLTET
RNAMAQAIGRETARLGLEKSRLETLLAEVPDGVLFCTPDHCVALYNGQARTVLDNSPALG
LNRSLADVILPGPVHQAYERLLAAEAQEGADILCATKAGAKLLEARMRLMWLDAQETKQP
GYILSLRDVTTDLKIHAERAHLLNSLLDAAKGAVTSKDPSAMEYLVSTTAEVAARKPLTD
TAWWPMEALAATDLGAALSSRLKRKGVPISTDLPALKLRCDGFAVTRLLERLALEWAAAG
ASALKLGFADDTQSTGRLVLSATGAPPDSETLTRWLATPLSPGLAQFAGRDVLVTHATRL
VPDPSGALHLTLPLADPRHRGTARVIQYDFELLHADIPKEIAEAALRQLNYVVFDTETTG
LNPQVDEICQIAAVRIVNGKIVDSERFDMLVDPGRRIPQGSIEVHGVTNEMVKGAPSVAE
ALKRFHAYADGAVLVAHNAPFDMSFLQRRETEIGARFDQPILDTVLCSAILFGQSAEHTL
DALCQRLGITIPEADRHTAIGDAIGTAAAFRKMIPMLEAADLPSLGATIKAFDKHARLIE
HLN
NT seq 1992 nt   +upstreamnt  +downstreamnt
atgtttacccatctcagtctgcgtttgcgcatattcctgttcttcgcccttctggccgtc
ggcggctccgccctgatgatcgcggggctgacgctcggatacatccgtctgggcgaagac
catgccctgcagagcttcgtgatcgcgggtgccatcggcgtcttggcgattttcgggctg
accgcttgggtctgggttctgttcgatgaaaacgtggcccgcccggtggaaagactggcc
gccgacatgcgggcgagggcccatgccgatgtcgatctggatatcgaccacgcaccggcg
cgttatctgggcgatctggcccctgctgcggcggcggtggcctcgaacctcaccgagacg
cgcaacgccatggcgcaggcgatcggtcgcgagaccgcacggctcggccttgagaaatcg
cggctggaaacacttctggccgaggtgccggatggtgttcttttctgcaccccggatcac
tgcgtggcgctatacaacggccaggcccggacggttctggacaacagcccggccctgggg
ctcaaccggtctctggccgatgtgatcctgccgggcccggtgcatcaggcctatgagcgg
ctgctggccgccgaagcgcaggagggcgcggatattctgtgtgccaccaaggcaggcgca
aagctgcttgaggcgcgcatgcggctgatgtggctcgacgcgcaggaaaccaaacagccg
ggctatattctgagcttgcgggatgtgacgaccgatctgaagatccacgcagagcgcgcc
catctgctgaactcccttcttgatgcggcgaaaggggccgtcaccagcaaggacccgagc
gcgatggagtaccttgtcagcaccacggccgaggtggccgcccgcaaacccctcacggat
accgcatggtggccgatggaagcccttgccgcgacagatctgggcgcggcgctgtcatca
cggctgaaacgcaagggcgtgcccatttccaccgatctgcccgccctgaaactgcgctgc
gacgggttcgcggtgacccggcttctggaacgtctggcgctggaatgggcggcggcgggc
gccagcgcattgaaactcggctttgcggatgacacgcagagcacgggccggcttgtgtta
tcagccacgggcgccccgcccgacagcgaaacgctgacgcgctggctggccacgccgctc
agtccgggtctggcgcagtttgccggccgggacgtgctggtgacgcatgccacgaggctg
gttcccgacccctccggcgcgctccatctgaccctgccgctcgcggatccgcggcaccgc
ggcaccgcacgggtgatccagtatgattttgagcttttgcatgcggatatcccaaaggag
atcgcggaggccgcgctcaggcagttgaactacgtggtgttcgataccgaaaccacgggg
ctgaacccgcaagtggacgagatctgccagatcgccgccgtgcggatcgtgaatggcaag
attgtcgatagcgagcggttcgacatgctggttgacccggggcggcgcattccgcagggc
tcgatcgaggtgcatggcgtgaccaacgaaatggtgaagggcgcgccatcggtcgcagag
gcgttgaaacggtttcacgcctatgcggatggcgcggttcttgtggcccataacgccccc
ttcgacatgagtttccttcagcgccgcgagaccgagataggcgcgcgcttcgatcagccc
attctggatacggtcctgtgttcggcgatcctgttcgggcaatcggccgagcacacgctg
gatgcgctttgccagcggcttggcatcacgatccccgaggccgacaggcatacggcaatc
ggcgacgccatcggcaccgcggcggcctttcgcaagatgatcccgatgctggaagcggca
gatctgcccagtttgggggcaacaatcaaggctttcgacaaacatgcccgcctgatcgag
catctcaattga

DBGET integrated database retrieval system