Rhodophyticola porphyridii: ABWH90_16045 Help Entry ABWH90_16045      CDS       T11241                                  Name (GenBank) rod-binding protein   KO K02395   peptidoglycan hydrolase FlgJ Organism rpoh  Rhodophyticola porphyridii Pathway rpoh02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:rpoh00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     ABWH90_16045  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:rpoh02035]     ABWH90_16045 Bacterial motility proteins [BR:rpoh02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     ABWH90_16045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rod-binding Motif Other DBs NCBI-ProteinID:  XHC06043 LinkDB All DBs Position complement(3206087..3206341) Genome browser AA seq 84 aa AA seqDB search MPPDAEARLRQAAVDLEASFLAEMLKQAKFGEARGAFGGGAGEEQFASFLRLEHARQMAA SGGIGLAENLFRSLAARHQGGASS NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcccccggacgcggaggcgcggctgcgtcaggctgcggtagatctggaagccagcttt ctcgccgaaatgctcaaacaggccaagttcggggaagcccgcggcgcgttcggcggcggc gcgggggaggaacagttcgcctctttcctgcggcttgagcatgcgcggcagatggcggca agcggtggaattgggctggcggagaatctcttccgttcgctggctgcgcgtcatcagggg ggcgcctcgtcatga

DBGET integrated database retrieval system