Rickettsia prowazekii Rp22: rpr22_CDS746 Help Entry rpr22_CDS746      CDS       T01977                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism rpq  Rickettsia prowazekii Rp22 Pathway rpq01100   Metabolic pathways rpq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rpq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     rpr22_CDS746 (acpP)    00074 Mycolic acid biosynthesis     rpr22_CDS746 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     rpr22_CDS746 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Ribosomal_L50 DUF1493 PP-binding_2 Motif Other DBs NCBI-ProteinID:  ADE30326 UniProt:  D5AY37 LinkDB All DBs Position 956045..956305 Genome browser AA seq 86 aa AA seqDB search MEFKIMSTTDKIEQKVIEMVAEKLNKDKAIITTDSRFIEDLKADSLDTVELMMAIEVEYG IDIPDDEATKIKTVSDVIKYIKERQS NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggagttcaaaattatgagtacaacggacaagatcgaacagaaagttattgaaatggtt gctgagaagctaaataaagataaagcgataataactacagattcaagatttatagaagat ttgaaagctgatagccttgataccgtagagttaatgatggcaatagaagttgaatacggt attgatatccctgatgatgaagccactaaaattaaaaccgtatccgatgtcataaaatat atcaaagaacgccaatcttaa

DBGET integrated database retrieval system