Ralstonia pseudosolanacearum RS 476: CDC45_02230 Help Entry CDC45_02230       CDS       T05645                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rpu  Ralstonia pseudosolanacearum RS 476 Pathway rpu00998   Biosynthesis of various antibiotics rpu01100   Metabolic pathways rpu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rpu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CDC45_02230    00074 Mycolic acid biosynthesis     CDC45_02230   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CDC45_02230 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AST26119 UniProt:  A0A223GJ76 LinkDB All DBs Position 463121..463405 Genome browser AA seq 94 aa AA seqDB search MSCPFACTMNALEKELAELMIGELNLEDIQLENVSADTPLYGEGFALDSIDILEIALLVS KKYGFELRSGNPDNQKIFATLGSLAAYIAAHRVR NT seq 285 nt NT seq  +upstreamnt  +downstreamnt gtgagctgcccgtttgcttgcacgatgaacgcactggaaaaagagctcgccgagctgatg atcggcgaactgaatctcgaagacatccaactcgaaaacgtgtccgccgataccccgcta tatggggaaggcttcgcgctcgactccatcgatatcctggaaatcgcgctgctggtctcg aaaaaatacggcttcgaactgcgctctgggaatccggataaccagaagatcttcgccacg ctcggttcgctggccgcttacatcgcggcgcaccgcgtgcgctag

DBGET integrated database retrieval system