Ralstonia pseudosolanacearum RS 476: CDC45_19300 Help Entry CDC45_19300       CDS       T05645                                  Name (GenBank) DNA-binding protein   KO K03746   DNA-binding protein H-NS Organism rpu  Ralstonia pseudosolanacearum RS 476 Brite KEGG Orthology (KO) [BR:rpu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:rpu03036]     CDC45_19300    03400 DNA repair and recombination proteins [BR:rpu03400]     CDC45_19300 Chromosome and associated proteins [BR:rpu03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     CDC45_19300 DNA repair and recombination proteins [BR:rpu03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       CDC45_19300 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N DUF5865 Motif Other DBs NCBI-ProteinID:  AST29386 LinkDB All DBs Position unnamed:442187..442477 Genome browser AA seq 96 aa AA seqDB search MPTYKELVAQKAKLEEQIEAARSKELEAVIQQVRQTVAEYGLTAEDLGLAPRRGRRAGAK APVPPKYRDPKTGATWSGRGRAPAWIGKNRDRFLIA NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgccgacatacaaggaattggttgctcaaaaggccaagcttgaagaacagattgaagcg gctcgctccaaagagctggaggcggtcattcaacaagtccgtcaaaccgtggccgaatat ggattgacggcggaagacctgggcctggcaccgcgccgcggtcgccgtgccggtgccaag gcgccggtgccgcccaagtatcgcgatccgaagacgggcgcaacgtggtcgggccgtggc cgtgctccggcctggatcggcaagaaccgcgaccggttcctgattgcctga

DBGET integrated database retrieval system