Ralstonia pseudosolanacearum RS 476: CDC45_25945 Help Entry CDC45_25945       CDS       T05645                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rpu  Ralstonia pseudosolanacearum RS 476 Pathway rpu00998   Biosynthesis of various antibiotics rpu01100   Metabolic pathways rpu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rpu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CDC45_25945 (acpP)    00074 Mycolic acid biosynthesis     CDC45_25945 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CDC45_25945 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 NPV_P10 Fas_alpha_ACP DUF7080 Motif Other DBs NCBI-ProteinID:  AST30582 LinkDB All DBs Position unnamed:2073762..2074025 Genome browser AA seq 87 aa AA seqDB search MSNPTVLDQIRHIIAQALDKPVETIHAEQSFRRDLGADSLDSVEIVMAIEDQFAVEFDED STAAVDTVQDLVTYIEAALASRGAQTA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagcaacccgaccgtcctcgaccagatccggcacatcattgcgcaagcactcgacaag cccgtcgagaccatccacgccgagcagtccttccgccgcgacctgggcgcggattcgctc gacagcgtcgagatcgtgatggccatcgaagaccagttcgcggtcgaattcgatgaggac agcaccgccgccgtcgatacggtgcaggacctggtcacctatatcgaagccgcgctggcc agccgcggcgcgcagaccgcatga

DBGET integrated database retrieval system