Agrobacterium pusense CFBP5875: CFBP5875_19950
Help
Entry
CFBP5875_19950 CDS
T06598
Symbol
cydD
Name
(GenBank) thiol reductant ABC exporter subunit CydD
KO
K16013
ATP-binding cassette, subfamily C, bacterial CydD
Organism
rpus
Agrobacterium pusense CFBP5875
Pathway
rpus02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
rpus00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
CFBP5875_19950 (cydD)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
rpus02000
]
CFBP5875_19950 (cydD)
Transporters [BR:
rpus02000
]
ABC transporters, eukaryotic type
ABCC (CFTR/MRP) subfamily
ABCC-BAC subgroup
CFBP5875_19950 (cydD)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
ABC_membrane
AAA_21
SMC_N
AAA_30
RsgA_GTPase
AAA_25
AAA_29
AAA_16
nSTAND1
AAA
Rad17
AAA_22
AAA_5
AAA_19
AAA_28
Motif
Other DBs
NCBI-ProteinID:
QCL87513
LinkDB
All DBs
Position
linear:1266199..1267845
Genome browser
AA seq
548 aa
AA seq
DB search
MHAPAAARSASLLHVLVSLFWLPQAGLLAFSVGKIADGAPMMALMPPAAAIFLLGILKAL
LEKTAARMSFRMARAALSQRRLEALHALARVSPLDLSRTASGEVAAVVAETSEALVPYLS
RFQPARMKATIVPVAYALVILPFSWIAALVLLLAMPTIPLFMALIGWQAKAASEKQLAEA
GNMNAFLLDRLRGLETIRALEAVDLTATRLSADAQNLKKRTMAVLRIAFLSSAVLELFAA
LGVAMTAVYIGFHLLGFLDFGAWGQKLTLAEGLFILLLAPAFFEPLRELSAVWHDRAAGE
AALGALDNLAKGGSAIAGTGKDARDVTVATPATVDLHDLTFAYPGASPVLRNFDFNVRAG
ETVALLGPSGCGKSTVLSLIAGLAKAQGGTIKIGGTVLEDETADILRKSIGLIGQKPFFT
AGSLEANIRFGRVGVTRSMVDMALESTGLDQLSSSRGHLPVGDGGHGISGGEAVRLAIAR
AFADPAARLILADEPTAHLDRETAELVTENLLQLAKGRTLIVATHDPVLAARMDRVVDMA
AVRSGDPS
NT seq
1647 nt
NT seq
+upstream
nt +downstream
nt
atgcacgcaccggcggcggcaagatcggcttccctgctgcatgttctcgtttcgctgttc
tggttgccacaggcgggtctgcttgccttttccgtcggaaaaattgctgatggtgcgcca
atgatggcgctcatgccgccggctgccgccatttttcttctcggtatcctcaaggccctt
ctggaaaaaaccgcagcgcgcatgtcgttccgtatggcgcgggcggctctttcgcagcgg
cggctggaagcgctccacgccctggccagggtctccccgctcgacctctcgcgaacggct
tccggtgaggtggcagctgtcgttgccgaaacgtcagaggcactggtgccctatctttcc
cgttttcagccggcaaggatgaaggcaacgatcgttccggtggcatatgccctcgtcatc
cttccgttcagctggatcgcggcgctggtgcttttgcttgccatgccgaccattccgctg
ttcatggctttgattggttggcaggccaaggccgccagtgaaaagcagcttgccgaggcc
ggcaatatgaacgcttttctgctcgaccggctgcgcgggctggaaacgattcgggcgctg
gaagcggtcgatctaacggccacacgcctgagcgccgatgcgcagaatctcaagaagaga
acgatggcggtgctcaggatcgcctttctctcatcggcagtgcttgagcttttcgcggcg
ctcggcgtcgccatgaccgccgtttacattggtttccatctgctcggctttctcgatttc
ggcgcgtggggtcagaaactgacgcttgccgaaggtcttttcatcttgcttctcgcgccg
gcatttttcgagcctctgcgggaattgtccgccgtctggcacgaccgggcggccggcgag
gctgcgctcggcgcgctcgacaatctggcgaagggtgggtcggctattgcaggcacgggc
aaggacgcgcgggacgtgacagttgcgacgccggcaaccgtagatttgcatgacctgacc
ttcgcctatcccggtgcatcacccgtgcttcgaaatttcgatttcaatgtccgggcgggt
gaaacagtggcacttctcggaccctccggttgcggcaaatccacggtgctctcccttatt
gccgggctcgccaaggcacagggcggcacgataaaaatcggcggcaccgtactcgaagat
gagacggcggacatattgcgcaaatccatcgggttgattggccagaagccgtttttcaca
gccggctcgctggaggcgaacattcgcttcggccgggtcggcgtcacgcggagcatggtt
gacatggcgcttgaaagcaccggcctcgatcagttgtcgtcttcccgcgggcatctgccg
gtgggagatggcggccatggcatttccggcggtgaagcggtgcggctcgccattgcccgt
gccttcgccgaccccgccgcacggctcattctggccgatgagccaacagcgcatctcgac
cgcgagacggccgaactcgttacggaaaacctgctgcaactggcaaagggaaggacgttg
atcgtcgcgacccatgatccggtgctggccgcgcgcatggacagggtcgtggatatggcg
gcggtgagatcgggagatccctcatga
DBGET
integrated database retrieval system