Rickettsia prowazekii RpGvF24: MA7_03695 Help Entry MA7_03695         CDS       T01793                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rpv  Rickettsia prowazekii RpGvF24 Pathway rpv01100   Metabolic pathways rpv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rpv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MA7_03695 (acpP)    00074 Mycolic acid biosynthesis     MA7_03695 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MA7_03695 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Ribosomal_L50 DUF1493 PP-binding_2 Motif Other DBs NCBI-ProteinID:  AFE53750 LinkDB All DBs Position 956529..956774 Genome browser AA seq 81 aa AA seqDB search MSTTDKIEQKVIEMVAEKLNKDKAIITTDSRFIEDLKADSLDTVELMMAIEVEYGIDIPD DEATKIKTVSDVIKYIKERQS NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagtacaacggacaagatcgaacagaaagttattgaaatggttgctgagaagctaaat aaagataaagcgataataactacagattcaagatttatagaagatttgaaagctgatagc cttgataccgtagagttaatgatggcaatagaagttgaatacggtattgatatccctgat gatgaagccactaaaattaaaaccgtatccgatgtcataaaatatatcaaagaacgccaa tcttaa

DBGET integrated database retrieval system