Rhodopseudomonas palustris DX-1: Rpdx1_2436 Help Entry Rpdx1_2436        CDS       T01381                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism rpx  Rhodopseudomonas palustris DX-1 Pathway rpx00190   Oxidative phosphorylation rpx01100   Metabolic pathways rpx02020   Two-component system Module rpx_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:rpx00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Rpdx1_2436  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Rpdx1_2436 Enzymes [BR:rpx01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      Rpdx1_2436 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ADU44027 UniProt:  E6VEJ5 LinkDB All DBs Position 2619439..2619591 Genome browser AA seq 50 aa AA seqDB search MWYFAWILGVTAAAAIAVINVMWYEFQDGLMVAVPTHDQPDGSQIPDRVV NT seq 153 nt NT seq  +upstreamnt  +downstreamnt atgtggtacttcgcctggattctcggcgtcaccgccgctgcggcgatcgccgtcatcaac gtgatgtggtacgagtttcaggacggtctgatggtcgcggtgccgacccacgaccaaccc gacggctcgcagatccccgaccgcgtcgtttag

DBGET integrated database retrieval system