Rubrobacter radiotolerans: RradSPS_0991 Help Entry RradSPS_0991      CDS       T03080                                  Name (GenBank) mttA/Hcf106 family   KO K03116   sec-independent protein translocase protein TatA Organism rrd  Rubrobacter radiotolerans Pathway rrd03060   Protein export rrd03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:rrd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     RradSPS_0991  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     RradSPS_0991  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:rrd02044]     RradSPS_0991 Secretion system [BR:rrd02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    RradSPS_0991 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  AHY46274 UniProt:  A0A023X2I3 LinkDB All DBs Position complement(1056334..1056534) Genome browser AA seq 66 aa AA seqDB search MGFGVLEVGILLFVVFLILGPKRIQGLLKSLGRSAHDFVDGLGGPSKEKNEEKTEKRSLP PGDRDD NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgggcttcggggtgctcgaggtcgggatactgctcttcgtcgttttcctgatcctcggc ccgaagaggattcagggcctcctcaagtccctcggccggagcgcccacgactttgtagac ggactcggcggcccgagcaaggagaaaaacgaggagaagactgagaaacgctccctgccg cccggcgacagggacgattag

DBGET integrated database retrieval system