Rubrobacter radiotolerans: RradSPS_1388 Help Entry RradSPS_1388      CDS       T03080                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rrd  Rubrobacter radiotolerans Pathway rrd01100   Metabolic pathways rrd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rrd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RradSPS_1388   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RradSPS_1388 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  AHY46671 UniProt:  A0A023X3B4 LinkDB All DBs Position 1462219..1462461 Genome browser AA seq 80 aa AA seqDB search MDREEALQKIQEITADRLGVEEADVTPEASFREDLEADSLDLVELIMELEEQFGMEIPDE DAEKITTVEEAVDYVMDHQS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggaccgcgaagaggcattgcagaagatccaggagataaccgcagaccggctcggggtg gaggaggccgacgtcacgcccgaggcgtcgttccgggaggacctcgaagccgactcgctc gacctcgtggagctgatcatggagctcgaggagcagttcgggatggagatcccggacgag gacgccgagaagatcacgaccgtcgaggaggccgttgactacgtaatggaccaccagtcc tag

DBGET integrated database retrieval system