Rhizobium ruizarguesonis: J3P73_36250 Help Entry J3P73_36250       CDS       T07270                                  Name (GenBank) hypothetical protein   KO K00788   thiamine-phosphate pyrophosphorylase [EC:2.5.1.3] Organism rrg  Rhizobium ruizarguesonis Pathway rrg00730   Thiamine metabolism rrg01100   Metabolic pathways rrg01240   Biosynthesis of cofactors Module rrg_M00899   Thiamine salvage pathway, HMP/HET => TMP Brite KEGG Orthology (KO) [BR:rrg00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00730 Thiamine metabolism     J3P73_36250 Enzymes [BR:rrg01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.3  thiamine phosphate synthase      J3P73_36250 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TMP-TENI Motif Other DBs NCBI-ProteinID:  QSZ05913 LinkDB All DBs Position p4:425424..425768 Genome browser AA seq 114 aa AA seqDB search MKLDPFYLIVDSAEWIARLVPLGVKLVQLRIKDRPETELRAEIRRAVEVPGNACRMLACS EVAISSRSPASARLDEMEPLATFARDESASNIQRSLTRPVAVPYEPNDYLGVLI NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgaagctcgatccgttctacctgatcgtcgacagcgccgaatggattgcccggctggta ccgcttggcgtcaagctggtgcagttgcgcatcaaggatcgtccggagactgaactacgc gccgagattcgtcgcgcagtagaggtgcccggaaacgcttgccgaatgcttgcctgcagt gaggtcgcgatcagtagcagaagtcccgcgagtgcgcgccttgacgaaatggaaccattg gccacattcgcgcgtgacgagagcgccagcaacatacagcgatcactcactcgccccgtg gcagtgccatatgagccaaacgattatttaggagttctgatttga

DBGET integrated database retrieval system