Rhizobium rhododendri: PR018_04085 Help Entry PR018_04085       CDS       T08971                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rrho  Rhizobium rhododendri Pathway rrho01100   Metabolic pathways rrho01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rrho00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PR018_04085    00074 Mycolic acid biosynthesis     PR018_04085   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PR018_04085 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Delta_lysin Motif Other DBs NCBI-ProteinID:  WFS23701 UniProt:  A0ABY8IJ28 LinkDB All DBs Position 821300..821536 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVVDHLGVDADKVVEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgttaagaaaattgttgttgatcatcttggcgtcgacgcc gacaaggttgttgaaggcgccagcttcatcgacgacctgggtgcggactcgctcgacact gtcgaactggtcatggcattcgaagaagaattcggcgttgaaatcccggacgacgccgcc gactccattctgacggttggcgacgctgtaaagttcatcgaaaaggcccaggcttaa

DBGET integrated database retrieval system