Roseovarius rhodophyticola: RZS32_006405 Help Entry RZS32_006405      CDS       T10617                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism rrl  Roseovarius rhodophyticola Pathway rrl00190   Oxidative phosphorylation rrl01100   Metabolic pathways Module rrl_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:rrl00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     RZS32_006405  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:rrl00194]     RZS32_006405 Photosynthesis proteins [BR:rrl00194]  Photosystem and electron transport system   F-type ATPase [OT]    RZS32_006405 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  WYK19489 LinkDB All DBs Position complement(1247794..1248030) Genome browser AA seq 78 aa AA seqDB search MEGDVVQMGAYIGAGLACTGMGGAAVGVGHVVGNFLSGALRNPSAAGGQTATMFIGIAFS EALGIFSFLVALLLMFAV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggaaggtgacgtcgtacaaatgggtgcatacatcggtgctggtctggcctgtacaggc atgggcggtgctgctgtgggtgtgggccacgttgttgggaacttcctgtcgggcgctttg cgtaacccgtcagcagccggtggccagaccgcaaccatgttcatcggtatcgcgttctcg gaagcgctggggatcttctcgttcctcgttgcccttctgctgatgttcgctgtctaa

DBGET integrated database retrieval system