KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104658736
Entry
104658736         CDS       T03989                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04927  Cortisol synthesis and secretion
rro04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    104658736 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104658736 (MRAP)
SSDB
Motif
Pfam: MRAP FixQ DUF420 EVC2_like
Other DBs
NCBI-GeneID: 104658736
NCBI-ProteinID: XP_010357112
UniProt: A0A2K6QGF6
LinkDB
Position
13:47617737..47636532
AA seq 172 aa
MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLILLYM
SWSGSPQMKNSTKHHQTCPWSHSLSLQLCIQKCLLCHREPLGTSQAQASSVEPGSRTGPD
QPLRQGSASTLPLGVFQTHPTLLWELTLNGGPLVRSKPSEPPPGDRTPQLQS
NT seq 519 nt   +upstreamnt  +downstreamnt
atggccaacgggaccaatgcctctgccccatactacagctatgaatactacctggactat
ctggacctcattcccgtagacgagaagaagctgaaagcccacaaacattccatcgtgatc
gcattctgggtgagcctggctgccttcgtggtgctcctcttcctcatcctgctctacatg
tcctggtcgggctccccgcagatgaagaacagtaccaagcaccaccaaacatgcccctgg
agtcacagcctcagcctccagctctgcatccagaagtgcctgctgtgccacagggaaccc
ctggggacctcacaggctcaggcgagttcagtggagccagggagcagaactggccctgac
cagccgctacgacaggggagcgcctccaccttgccccttggggttttccagacccacccc
actctcctctgggaactgaccctcaatgggggtcccctcgtcaggagcaagcccagcgag
cctccccctggagacaggacccctcaattgcagagctga

DBGET integrated database retrieval system