KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104661579
Entry
104661579         CDS       T03989                                 
Name
(RefSeq) integrin alpha-X isoform X1
  KO
K06462  integrin alpha X
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04610  Complement and coagulation cascades
rro04810  Regulation of actin cytoskeleton
rro05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104661579
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    104661579
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104661579
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rro04515]
    104661579
   04090 CD molecules [BR:rro04090]
    104661579
Cell adhesion molecules [BR:rro04515]
 Integrins
  Integrin alpha subunits
   104661579
CD molecules [BR:rro04090]
 Proteins
  104661579
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 Integrin_alpha FG-GAP_2 VWA_CoxE
Other DBs
NCBI-GeneID: 104661579
NCBI-ProteinID: XP_010360572
UniProt: A0A2K6NYI4
LinkDB
Position
20:10575261..10604768
AA seq 1154 aa
MTRTKAALLLFTALATSLGFNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQERTAA
NQTGSLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLAATTSPPQLLACGPTVHHGCGRNM
YLTGLCFLLAPTQLTQRLPASGQECPRQELDIVFLIDGSGSISPGNFATMMNFVRAVISQ
FQRPSTQFSLMQFSSEFYVHFTFEEFRLTSNPLGLLASVHQLRGLTRTATAIQKVVRQLF
QASHGARGDATKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAVGVGSAFKNTNSWKE
LNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVF
TPDGPILGAVGSFTWSGGAFLYPPNMNPTFINMSQENVDMRDSYLGYSTELAFWKGVQNL
VLGAPRYQHTGKAAIFIQVSGQWRLKAEVTGTQIGSYFGASLCSVDVDGDGSTDLILIGA
PHYYEQTRGGQVSVCPLPRGWRRWWCDAVLHGEQGHPWGRFGAALTVLGDVNGDKLTDVV
IGAPGEEENQGAVYLFHGALGPSIGPSHSQRIGGSQLSPRLQYFGQALSGGQDLTQDGLV
DLAVGARGQVLLLRTRPVLWVGVSMQFKPAEIPRSAFECREQVVSDQILGQSSICLYIDK
RSKNLLGSRDLQSSLTMDLALDPGRLSPRATFQETKNRSLSRVQVLGLQAYCETFTLLLP
TCVEDSVTPITLRLNFTLVGEPLSAFRNLRPMLAADAQRYFMASLPFEKNCGADHICQDN
LGISFSFPGLKTLLVGSNLELNAEVIVWNDGEDSYGTTITFSHPAGLSYRHVAESQKQGQ
LRSLRLTCDSAPAGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANV
SSENNTPRTNKTTFQLELPLKYAVYTVASSHEQSTKYLNFSDSEEKESRVAMHRYQVNNL
GQRDLPVSINFWVPVELNQEAVWMEVEVSHPQNPSLRCSSEKIAPPASDFLAYIQKNPVL
DCSIAGCLRFRCDVPSFSIQEELDFTLKGNLSFAWVRQTSQKKVSVVSVAEITFDTSVYS
QLPGQEAFMRAQTTTVLEKYEVHNPTPLIIGSSIGGLLLLALITAALYKVGFFKRQYKEM
MEEANGQIAPENRT
NT seq 3465 nt   +upstreamnt  +downstreamnt
atgaccaggaccaaggcagcgctcctcctgttcacagccttagcaacttctctgggtttc
aacttggacacagaggagctgacagccttccgtgtggacagcgctgggtttggagacagt
gtggtccagtatgccaactcctgggtggtggttggagccccccaagagagaacagctgcc
aaccaaacgggcagcctctaccagtgcggctacagcaccggtgcctgtgaacccattggc
ctgcaggtgcccccggaggccgtgaacatgtccctgggcctgtccctggcggctaccacc
agtcccccccagctgctggcctgcggccccaccgtgcaccatgggtgtgggaggaacatg
tacctgaccggactctgcttcctcctggcccccacccagctcacccagaggctcccggcg
tccgggcaggagtgcccaagacaggagctggacattgtgttcctgattgatggctcgggc
agcatctcccccggcaactttgccacgatgatgaacttcgtgagagctgtgataagccag
ttccagagacccagcacccagttttccctgatgcagttctccagtgaattctacgtacac
ttcacttttgaggaattcaggctcacctcaaaccccctcggcctgttggcttctgttcac
caactgagagggttgacacgcacggccactgccatccaaaaagtcgtgcgccaattgttc
caggcctcacacggggcccgtggggatgccactaaaattctcattgtcatcactgatggg
aagaaagaaggcgacagcctggattataaggatgtcatccccatggctgatgcagcaggc
atcatccgctatgcagttggggttggatcagcttttaaaaacacaaactcttggaaagaa
ttaaatgacattgcatcgaagccctcccaggaacacatatttaaagtggaggactttgat
gctctgaaagatattcaaaaccagctgaaggagaagatctttgccattgaaggtacggag
accacaagcagtagctccttcgaattggagatggcgcaggagggcttcagcgctgtgttc
acgcctgatggccccattctgggggctgtggggagcttcacctggtctggaggtgccttc
ctgtatcccccaaatatgaaccccaccttcatcaacatgtctcaggagaatgtggacatg
agggactcttacctgggttactccactgagctggctttctggaaaggggtgcagaacctg
gtcctgggggccccccgctaccagcacactgggaaggctgccatcttcatccaggtgtcc
gggcaatggaggctgaaggccgaagtcacggggacacagattggttcctacttcggggct
tccctctgctccgtggatgtggatggcgatggcagcactgacctgatcctcatcggggcc
ccccattactacgagcagacccgagggggccaggtgtccgtgtgtcctttgcccaggggg
tggagaaggtggtggtgtgatgctgttctccacggggagcagggccatccctggggtcgc
tttggggcagctctgacagtgctgggggacgtgaatggggacaagctgacggacgtggtc
atcggggccccaggagaggaagagaaccagggtgctgtctacctgtttcacggagccttg
ggacctagcatcggcccctcccacagccagcggatcgggggctcccagctctcccccagg
ctgcagtattttgggcaggcactgagcggcggtcaagacctcacccaggatggactggtg
gacctggctgtgggggcccggggccaggtgctcctgctcaggacaagacctgtgctctgg
gtaggggtgagcatgcagttcaaacctgccgagatccccaggtctgcatttgagtgtcgg
gagcaggtggtctctgaccagatcctgggacagtccagcatctgcctttacattgacaaa
cgttccaagaacctgcttgggagccgtgacctccaaagctctctgacgatggacctggct
ctcgaccctggccgcctgagtccccgtgccaccttccaggaaacaaagaaccggagtctg
agccgagtccaagtcctcgggctgcaggcatactgtgaaaccttcaccctgctgctcccg
acctgcgtggaggactctgtgacccccatcaccttgcgtctgaacttcacgctggtgggc
gagcccctctctgccttcagaaacctgcggcctatgctggccgctgatgctcagagatac
ttcatggcctccctcccctttgagaagaactgtggagccgaccatatctgccaggacaat
ctcggcatctccttcagcttcccaggcttgaagaccctactggtggggagtaacctggag
ctgaacgcagaagtgatagtgtggaatgacggggaagactcctacggaaccaccatcacc
ttctcccacccagcaggactgtcctaccgccatgtggcagagagccagaaacaggggcag
ctgcgttccctgcgcctgacatgtgacagcgccccagctgggagccagggcacctggagt
accagctgcagaatcaaccacctcatcttccgtggtggtgcccagatcaccttcttggct
acctttgacgtctcccccaaggctgtcctgggagaccggctgcttctgacagccaatgtg
agcagtgagaacaacacccccaggacgaacaagaccaccttccagctggagctcccgctg
aagtatgccgtctacactgtggctagcagccacgaacaatccaccaagtacctcaacttc
tcagactctgaggagaaggagagccgtgtggccatgcacagataccaggttaataacctg
ggacagagggacctgcctgtcagcatcaacttctgggtgcctgtggagctgaaccaggag
gctgtgtggatggaggtggaggtctcccacccccagaacccatcccttcggtgctcctca
gagaaaatcgcacccccagcgtctgacttcctggcatacattcagaagaatcccgtgctg
gactgctccattgctggctgcctgcggttccgctgtgatgtgccctccttcagcatccag
gaggagctggatttcaccctgaagggcaacctcagtttcgcctgggtccgccagacatcg
cagaagaaggtgtcggtcgtgagtgtggctgaaattacgtttgacacatccgtgtactcc
cagcttccaggacaggaggcatttatgagagctcagacgacaacggtgctggagaagtac
gaggtccacaaccccacccccctcatcataggcagctccattgggggtctgctgctgctg
gcgctcatcacagcagcactgtacaaagttggcttcttcaagcgtcagtacaaggaaatg
atggaggaggcaaatggacaaattgctccagaaaacaggacatag

DBGET integrated database retrieval system