KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670041
Entry
104670041         CDS       T03989                                 
Symbol
KRAS
Name
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04062  Chemokine signaling pathway
rro04068  FoxO signaling pathway
rro04071  Sphingolipid signaling pathway
rro04072  Phospholipase D signaling pathway
rro04137  Mitophagy - animal
rro04140  Autophagy - animal
rro04150  mTOR signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04210  Apoptosis
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04218  Cellular senescence
rro04360  Axon guidance
rro04370  VEGF signaling pathway
rro04371  Apelin signaling pathway
rro04540  Gap junction
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04625  C-type lectin receptor signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro04660  T cell receptor signaling pathway
rro04662  B cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04714  Thermogenesis
rro04720  Long-term potentiation
rro04722  Neurotrophin signaling pathway
rro04725  Cholinergic synapse
rro04726  Serotonergic synapse
rro04730  Long-term depression
rro04810  Regulation of actin cytoskeleton
rro04910  Insulin signaling pathway
rro04912  GnRH signaling pathway
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04917  Prolactin signaling pathway
rro04919  Thyroid hormone signaling pathway
rro04921  Oxytocin signaling pathway
rro04926  Relaxin signaling pathway
rro04929  GnRH secretion
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04935  Growth hormone synthesis, secretion and action
rro04960  Aldosterone-regulated sodium reabsorption
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05034  Alcoholism
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05207  Chemical carcinogenesis - receptor activation
rro05208  Chemical carcinogenesis - reactive oxygen species
rro05210  Colorectal cancer
rro05211  Renal cell carcinoma
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05216  Thyroid cancer
rro05218  Melanoma
rro05219  Bladder cancer
rro05220  Chronic myeloid leukemia
rro05221  Acute myeloid leukemia
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05230  Central carbon metabolism in cancer
rro05231  Choline metabolism in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rro05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104670041 (KRAS)
   04012 ErbB signaling pathway
    104670041 (KRAS)
   04014 Ras signaling pathway
    104670041 (KRAS)
   04015 Rap1 signaling pathway
    104670041 (KRAS)
   04370 VEGF signaling pathway
    104670041 (KRAS)
   04371 Apelin signaling pathway
    104670041 (KRAS)
   04068 FoxO signaling pathway
    104670041 (KRAS)
   04072 Phospholipase D signaling pathway
    104670041 (KRAS)
   04071 Sphingolipid signaling pathway
    104670041 (KRAS)
   04151 PI3K-Akt signaling pathway
    104670041 (KRAS)
   04150 mTOR signaling pathway
    104670041 (KRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104670041 (KRAS)
   04137 Mitophagy - animal
    104670041 (KRAS)
  09143 Cell growth and death
   04210 Apoptosis
    104670041 (KRAS)
   04218 Cellular senescence
    104670041 (KRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104670041 (KRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    104670041 (KRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104670041 (KRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104670041 (KRAS)
   04650 Natural killer cell mediated cytotoxicity
    104670041 (KRAS)
   04660 T cell receptor signaling pathway
    104670041 (KRAS)
   04662 B cell receptor signaling pathway
    104670041 (KRAS)
   04664 Fc epsilon RI signaling pathway
    104670041 (KRAS)
   04062 Chemokine signaling pathway
    104670041 (KRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104670041 (KRAS)
   04929 GnRH secretion
    104670041 (KRAS)
   04912 GnRH signaling pathway
    104670041 (KRAS)
   04915 Estrogen signaling pathway
    104670041 (KRAS)
   04914 Progesterone-mediated oocyte maturation
    104670041 (KRAS)
   04917 Prolactin signaling pathway
    104670041 (KRAS)
   04921 Oxytocin signaling pathway
    104670041 (KRAS)
   04926 Relaxin signaling pathway
    104670041 (KRAS)
   04935 Growth hormone synthesis, secretion and action
    104670041 (KRAS)
   04919 Thyroid hormone signaling pathway
    104670041 (KRAS)
   04916 Melanogenesis
    104670041 (KRAS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    104670041 (KRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    104670041 (KRAS)
   04726 Serotonergic synapse
    104670041 (KRAS)
   04720 Long-term potentiation
    104670041 (KRAS)
   04730 Long-term depression
    104670041 (KRAS)
   04722 Neurotrophin signaling pathway
    104670041 (KRAS)
  09158 Development and regeneration
   04360 Axon guidance
    104670041 (KRAS)
  09149 Aging
   04211 Longevity regulating pathway
    104670041 (KRAS)
   04213 Longevity regulating pathway - multiple species
    104670041 (KRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    104670041 (KRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104670041 (KRAS)
   05206 MicroRNAs in cancer
    104670041 (KRAS)
   05205 Proteoglycans in cancer
    104670041 (KRAS)
   05207 Chemical carcinogenesis - receptor activation
    104670041 (KRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    104670041 (KRAS)
   05203 Viral carcinogenesis
    104670041 (KRAS)
   05230 Central carbon metabolism in cancer
    104670041 (KRAS)
   05231 Choline metabolism in cancer
    104670041 (KRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104670041 (KRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104670041 (KRAS)
   05212 Pancreatic cancer
    104670041 (KRAS)
   05225 Hepatocellular carcinoma
    104670041 (KRAS)
   05226 Gastric cancer
    104670041 (KRAS)
   05214 Glioma
    104670041 (KRAS)
   05216 Thyroid cancer
    104670041 (KRAS)
   05221 Acute myeloid leukemia
    104670041 (KRAS)
   05220 Chronic myeloid leukemia
    104670041 (KRAS)
   05218 Melanoma
    104670041 (KRAS)
   05211 Renal cell carcinoma
    104670041 (KRAS)
   05219 Bladder cancer
    104670041 (KRAS)
   05215 Prostate cancer
    104670041 (KRAS)
   05213 Endometrial cancer
    104670041 (KRAS)
   05224 Breast cancer
    104670041 (KRAS)
   05223 Non-small cell lung cancer
    104670041 (KRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104670041 (KRAS)
   05170 Human immunodeficiency virus 1 infection
    104670041 (KRAS)
   05161 Hepatitis B
    104670041 (KRAS)
   05160 Hepatitis C
    104670041 (KRAS)
   05163 Human cytomegalovirus infection
    104670041 (KRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104670041 (KRAS)
   05165 Human papillomavirus infection
    104670041 (KRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104670041 (KRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    104670041 (KRAS)
  09165 Substance dependence
   05034 Alcoholism
    104670041 (KRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    104670041 (KRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104670041 (KRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104670041 (KRAS)
   01522 Endocrine resistance
    104670041 (KRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104670041 (KRAS)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rro04031]
    104670041 (KRAS)
Membrane trafficking [BR:rro04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    104670041 (KRAS)
GTP-binding proteins [BR:rro04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    104670041 (KRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin DUF6974
Other DBs
NCBI-GeneID: 104670041
NCBI-ProteinID: XP_030794568
UniProt: A0A2K6QVV1
LinkDB
Position
10:complement(132620311..132670460)
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIIM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcattttgtggacgaatatgatccaacaatagaggattcctac
aggaagcaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccaatacatgaggactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaatt
aaaagagttaaggactctgaagatgtacctatggtcctagtaggaaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttacggaattcct
tttattgaaacatcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacaatacagattgaaaaaaatcagcaaagaagaaaagactcctggctgt
gtgaaaattaaaaaatgcattataatgtaa

DBGET integrated database retrieval system