KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104681150
Entry
104681150         CDS       T03989                                 
Symbol
MAPK3
Name
(RefSeq) LOW QUALITY PROTEIN: mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro01524  Platinum drug resistance
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04066  HIF-1 signaling pathway
rro04068  FoxO signaling pathway
rro04071  Sphingolipid signaling pathway
rro04072  Phospholipase D signaling pathway
rro04114  Oocyte meiosis
rro04140  Autophagy - animal
rro04148  Efferocytosis
rro04150  mTOR signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04210  Apoptosis
rro04218  Cellular senescence
rro04261  Adrenergic signaling in cardiomyocytes
rro04270  Vascular smooth muscle contraction
rro04350  TGF-beta signaling pathway
rro04360  Axon guidance
rro04370  VEGF signaling pathway
rro04371  Apelin signaling pathway
rro04380  Osteoclast differentiation
rro04510  Focal adhesion
rro04517  IgSF CAM signaling
rro04520  Adherens junction
rro04540  Gap junction
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04611  Platelet activation
rro04613  Neutrophil extracellular trap formation
rro04620  Toll-like receptor signaling pathway
rro04621  NOD-like receptor signaling pathway
rro04625  C-type lectin receptor signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro04657  IL-17 signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro04660  T cell receptor signaling pathway
rro04662  B cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04666  Fc gamma R-mediated phagocytosis
rro04668  TNF signaling pathway
rro04713  Circadian entrainment
rro04720  Long-term potentiation
rro04722  Neurotrophin signaling pathway
rro04723  Retrograde endocannabinoid signaling
rro04724  Glutamatergic synapse
rro04725  Cholinergic synapse
rro04726  Serotonergic synapse
rro04730  Long-term depression
rro04810  Regulation of actin cytoskeleton
rro04910  Insulin signaling pathway
rro04912  GnRH signaling pathway
rro04914  Progesterone-mediated oocyte maturation
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04917  Prolactin signaling pathway
rro04919  Thyroid hormone signaling pathway
rro04921  Oxytocin signaling pathway
rro04926  Relaxin signaling pathway
rro04928  Parathyroid hormone synthesis, secretion and action
rro04929  GnRH secretion
rro04930  Type II diabetes mellitus
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04960  Aldosterone-regulated sodium reabsorption
rro05010  Alzheimer disease
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05034  Alcoholism
rro05132  Salmonella infection
rro05133  Pertussis
rro05135  Yersinia infection
rro05140  Leishmaniasis
rro05142  Chagas disease
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05207  Chemical carcinogenesis - receptor activation
rro05208  Chemical carcinogenesis - reactive oxygen species
rro05210  Colorectal cancer
rro05211  Renal cell carcinoma
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05216  Thyroid cancer
rro05218  Melanoma
rro05219  Bladder cancer
rro05220  Chronic myeloid leukemia
rro05221  Acute myeloid leukemia
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05230  Central carbon metabolism in cancer
rro05231  Choline metabolism in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rro05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104681150 (MAPK3)
   04012 ErbB signaling pathway
    104681150 (MAPK3)
   04014 Ras signaling pathway
    104681150 (MAPK3)
   04015 Rap1 signaling pathway
    104681150 (MAPK3)
   04350 TGF-beta signaling pathway
    104681150 (MAPK3)
   04370 VEGF signaling pathway
    104681150 (MAPK3)
   04371 Apelin signaling pathway
    104681150 (MAPK3)
   04668 TNF signaling pathway
    104681150 (MAPK3)
   04066 HIF-1 signaling pathway
    104681150 (MAPK3)
   04068 FoxO signaling pathway
    104681150 (MAPK3)
   04072 Phospholipase D signaling pathway
    104681150 (MAPK3)
   04071 Sphingolipid signaling pathway
    104681150 (MAPK3)
   04024 cAMP signaling pathway
    104681150 (MAPK3)
   04022 cGMP-PKG signaling pathway
    104681150 (MAPK3)
   04151 PI3K-Akt signaling pathway
    104681150 (MAPK3)
   04150 mTOR signaling pathway
    104681150 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    104681150 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104681150 (MAPK3)
   04148 Efferocytosis
    104681150 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    104681150 (MAPK3)
   04210 Apoptosis
    104681150 (MAPK3)
   04218 Cellular senescence
    104681150 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104681150 (MAPK3)
   04520 Adherens junction
    104681150 (MAPK3)
   04540 Gap junction
    104681150 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    104681150 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104681150 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104681150 (MAPK3)
   04613 Neutrophil extracellular trap formation
    104681150 (MAPK3)
   04620 Toll-like receptor signaling pathway
    104681150 (MAPK3)
   04621 NOD-like receptor signaling pathway
    104681150 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    104681150 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    104681150 (MAPK3)
   04660 T cell receptor signaling pathway
    104681150 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    104681150 (MAPK3)
   04659 Th17 cell differentiation
    104681150 (MAPK3)
   04657 IL-17 signaling pathway
    104681150 (MAPK3)
   04662 B cell receptor signaling pathway
    104681150 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    104681150 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    104681150 (MAPK3)
   04062 Chemokine signaling pathway
    104681150 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104681150 (MAPK3)
   04929 GnRH secretion
    104681150 (MAPK3)
   04912 GnRH signaling pathway
    104681150 (MAPK3)
   04915 Estrogen signaling pathway
    104681150 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    104681150 (MAPK3)
   04917 Prolactin signaling pathway
    104681150 (MAPK3)
   04921 Oxytocin signaling pathway
    104681150 (MAPK3)
   04926 Relaxin signaling pathway
    104681150 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    104681150 (MAPK3)
   04919 Thyroid hormone signaling pathway
    104681150 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    104681150 (MAPK3)
   04916 Melanogenesis
    104681150 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104681150 (MAPK3)
   04270 Vascular smooth muscle contraction
    104681150 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    104681150 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    104681150 (MAPK3)
   04725 Cholinergic synapse
    104681150 (MAPK3)
   04726 Serotonergic synapse
    104681150 (MAPK3)
   04720 Long-term potentiation
    104681150 (MAPK3)
   04730 Long-term depression
    104681150 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    104681150 (MAPK3)
   04722 Neurotrophin signaling pathway
    104681150 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    104681150 (MAPK3)
   04380 Osteoclast differentiation
    104681150 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104681150 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104681150 (MAPK3)
   05206 MicroRNAs in cancer
    104681150 (MAPK3)
   05205 Proteoglycans in cancer
    104681150 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    104681150 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    104681150 (MAPK3)
   05203 Viral carcinogenesis
    104681150 (MAPK3)
   05230 Central carbon metabolism in cancer
    104681150 (MAPK3)
   05231 Choline metabolism in cancer
    104681150 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104681150 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104681150 (MAPK3)
   05212 Pancreatic cancer
    104681150 (MAPK3)
   05225 Hepatocellular carcinoma
    104681150 (MAPK3)
   05226 Gastric cancer
    104681150 (MAPK3)
   05214 Glioma
    104681150 (MAPK3)
   05216 Thyroid cancer
    104681150 (MAPK3)
   05221 Acute myeloid leukemia
    104681150 (MAPK3)
   05220 Chronic myeloid leukemia
    104681150 (MAPK3)
   05218 Melanoma
    104681150 (MAPK3)
   05211 Renal cell carcinoma
    104681150 (MAPK3)
   05219 Bladder cancer
    104681150 (MAPK3)
   05215 Prostate cancer
    104681150 (MAPK3)
   05213 Endometrial cancer
    104681150 (MAPK3)
   05224 Breast cancer
    104681150 (MAPK3)
   05223 Non-small cell lung cancer
    104681150 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104681150 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    104681150 (MAPK3)
   05161 Hepatitis B
    104681150 (MAPK3)
   05160 Hepatitis C
    104681150 (MAPK3)
   05171 Coronavirus disease - COVID-19
    104681150 (MAPK3)
   05164 Influenza A
    104681150 (MAPK3)
   05163 Human cytomegalovirus infection
    104681150 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104681150 (MAPK3)
   05165 Human papillomavirus infection
    104681150 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104681150 (MAPK3)
   05135 Yersinia infection
    104681150 (MAPK3)
   05133 Pertussis
    104681150 (MAPK3)
   05152 Tuberculosis
    104681150 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104681150 (MAPK3)
   05140 Leishmaniasis
    104681150 (MAPK3)
   05142 Chagas disease
    104681150 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104681150 (MAPK3)
   05020 Prion disease
    104681150 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    104681150 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    104681150 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    104681150 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    104681150 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    104681150 (MAPK3)
   04934 Cushing syndrome
    104681150 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104681150 (MAPK3)
   01524 Platinum drug resistance
    104681150 (MAPK3)
   01522 Endocrine resistance
    104681150 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104681150 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rro03036]
    104681150 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104681150 (MAPK3)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     104681150 (MAPK3)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   104681150 (MAPK3)
Chromosome and associated proteins [BR:rro03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     104681150 (MAPK3)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104681150 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Kdo FTA2
Other DBs
NCBI-GeneID: 104681150
NCBI-ProteinID: XP_010385672
UniProt: A0A2K6QTM1
LinkDB
Position
20:8968382..8977572
AA seq 379 aa
MAAAAAQGGGGGEPRRAEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY
DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERL
KELIFQETARFQPGALEAP
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggctcaggggggcgggggtggggagccccggagagccgagggggtc
ggcccgggggtcccgggggaggtggagatggtgaaagggcagccgttcgacgtgggcccg
cgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtcagctcggcctat
gaccacgtgcgcaagactcgcgtggccatcaagaagatcagccccttcgagcatcagacc
tactgccagcgcacgctccgggagatccagatcctgctgcgcttccgccatgagaatgtc
atcggcatccgagacattctgcgggcgtccaccctggaagccatgagggatgtctacatt
gtgcaggacctgatggagactgacctgtataagttgctgaaaagccagcaactgagcaat
gaccacatctgctacttcctctaccagatcctgcggggcctcaagtacatccactccgcc
aatgtgctccaccgggatctaaagccctccaacctgctcatcaataccacctgcgacctt
aagatttgcgatttcggcctggcccggattgccgatcctgagcatgaccacactggcttc
ctgacggagtatgtggctacacgctggtaccgggccccagagatcatgctgaactccaag
ggctataccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctctct
aaccggcccatcttccctggcaagcactacctggatcagctcaaccacattctgggcatc
ctgggctccccatcccaggaggacctgaattgtatcatcaacatgaaggcccgaaactac
ctacagtctctgccctccaagaccaaggtggcttgggccaagcttttccccaagtcagac
tccaaagcccttgacctgctggaccggatgttaacctttaaccccaataaacggatcaca
gtggaggaagcgctggctcacccctacctggagcagtactatgacccgacggatgagcca
gtggccgaggagcccttcaccttcgccatggagctggatgacctacctaaggagcggctg
aaggagctcatcttccaggagacagcacgcttccagcccggagcgctagaggccccctaa

DBGET integrated database retrieval system