Rhizobium rosettiformans: D4A92_09020
Help
Entry
D4A92_09020 CDS
T08393
Symbol
phoB
Name
(GenBank) phosphate regulon transcriptional regulatory protein PhoB
KO
K07657
two-component system, OmpR family, phosphate regulon response regulator PhoB
Organism
rros
Rhizobium rosettiformans
Pathway
rros02020
Two-component system
Brite
KEGG Orthology (KO) [BR:
rros00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
D4A92_09020 (phoB)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
rros02022
]
D4A92_09020 (phoB)
Two-component system [BR:
rros02022
]
OmpR family
PhoR-PhoB (phosphate starvation response)
D4A92_09020 (phoB)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Response_reg
Trans_reg_C
GerE
Motif
Other DBs
NCBI-ProteinID:
QRF51566
UniProt:
A0A7W8HT63
LinkDB
All DBs
Position
1890289..1890972
Genome browser
AA seq
227 aa
AA seq
DB search
MQPKIAVVEDEEALSVLLRYNLEAEGYEVETILRGDEAEIRLQERVPDLLILDWMLPGVS
GIELCRRLRVRPETERLPIIMLTARGEESERVRGLATGADDYVVKPFSTPELMARVKAML
RRAKPEVLSSVLRCGDIELDRETHRVHRKSREVRLGPTEFRLLEFLMASPGRVFSRSQLL
DGVWGHDIYVDERTVDVHVGRLRKALNFSNMQDVIRTVRGAGYSMEA
NT seq
684 nt
NT seq
+upstream
nt +downstream
nt
atgcagccgaagattgccgtagtcgaagacgaggaggccctttcggtcctcctgcgttac
aatctcgaagccgagggttatgaggtcgaaacgatcctgcggggcgacgaagccgagatc
cggcttcaggagcgcgtgcccgatctcctgatcctggactggatgcttccgggcgtctcc
ggcatcgaactgtgccgccgtttgcgcgtgcgacccgagaccgagcgtctgccgatcatc
atgctgacggcgcgcggcgaggaaagcgagcgcgtgcgtggtctggcgacaggtgccgac
gactatgtcgtcaagcccttctctaccccggaactgatggctcgcgttaaggccatgttg
cggcgtgccaagcccgaagtcctgtccagcgtcctgcgctgcggcgacatcgagcttgat
cgcgagacgcatcgggtgcatcgcaagagccgcgaggttcgtctcgggccgaccgagttc
cgccttctggagttcctgatggcgtcgcctggccgggtcttctctcgctcgcagcttctc
gacggtgtctggggccacgacatctatgtcgacgaacgtacggtcgacgtgcatgtcggt
cgcctgcgcaaggcgctcaacttctccaacatgcaggatgtcatccgcaccgttcgcggt
gccggctattcgatggaagcctga
DBGET
integrated database retrieval system